PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr5P03360_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family NAC
Protein Properties Length: 358aa    MW: 40083.2 Da    PI: 5.4813
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr5P03360_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.74.6e-5361331128
                    NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                            lppGfrFhPtdeelv +yLk+kv+g k+el evi+ +d++k++Pw+Lp k  +  ++ ew+fF++rd+ky++g+r+nrat sgyWk+t
  GSMUA_Achr5P03360_001   6 LPPGFRFHPTDEELVGYYLKRKVDGLKIEL-EVIPVIDLCKFDPWELPdKsLLPRRDMEWFFFCPRDRKYPNGSRTNRATVSGYWKST 92 
                            79****************************.99**************95434455788****************************** PP

                    NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                            gkd+++ + ++++ gl+ktLvfy+grap ge+tdW+mheyrl
  GSMUA_Achr5P03360_001  93 GKDRKISC-ESSVFGLRKTLVFYRGRAPGGERTDWIMHEYRL 133
                            ********.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.4E-602155IPR003441NAC domain
PROSITE profilePS5100556.6866156IPR003441NAC domain
PfamPF023655.0E-297133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008283Biological Processcell proliferation
GO:0071365Biological Processcellular response to auxin stimulus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MNAMLLPPGF RFHPTDEELV GYYLKRKVDG LKIELEVIPV IDLCKFDPWE LPDKSLLPRR  60
DMEWFFFCPR DRKYPNGSRT NRATVSGYWK STGKDRKISC ESSVFGLRKT LVFYRGRAPG  120
GERTDWIMHE YRLCEDLFQG SSNFLGAFAL CRVVKRSGNG VTSSDRHGEP KAKRCPKRNF  180
DEALHGTEES SSLDLIDSSC NASDLLPSPE TVIAFREPHV ISDASKVQSA ALKNSISWYV  240
NKNTIIVFFG LQADGGASMP SDGVPNPTRE AFTVDEPGNA LFSSFPSPAA RCMGMCMCSS  300
SWEDITFHSL RWDATTYIDE SYGTEDFGAA ASAHICRQAS EGEEANLWLQ EDNIVTVM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-55115712166NO APICAL MERISTEM PROTEIN
1ut4_B4e-55115712166NO APICAL MERISTEM PROTEIN
1ut7_A4e-55115712166NO APICAL MERISTEM PROTEIN
1ut7_B4e-55115712166NO APICAL MERISTEM PROTEIN
3swm_A4e-55115715169NAC domain-containing protein 19
3swm_B4e-55115715169NAC domain-containing protein 19
3swm_C4e-55115715169NAC domain-containing protein 19
3swm_D4e-55115715169NAC domain-containing protein 19
3swp_A4e-55115715169NAC domain-containing protein 19
3swp_B4e-55115715169NAC domain-containing protein 19
3swp_C4e-55115715169NAC domain-containing protein 19
3swp_D4e-55115715169NAC domain-containing protein 19
4dul_A4e-55115712166NAC domain-containing protein 19
4dul_B4e-55115712166NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00439DAPTransfer from AT4G17980Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009400096.10.0PREDICTED: NAC domain-containing protein 72-like
TrEMBLM0SVB50.0M0SVB5_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr5P03360_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62093854
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17980.13e-85NAC domain containing protein 71